PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_15385A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family LBD
Protein Properties Length: 198aa    MW: 21492 Da    PI: 6.7011
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_15385AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260131.14.8e-41261224100
                     DUF260   4 aCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqql 87 
                                 Ck+lrr+C++ Cvlapyfp ++p+kfa +h++FGasn++kll++lpee+r+da+ss+vyeA ar+rdPvyG++g i++lq+q+
  Oropetium_20150105_15385A  26 XCKILRRRCVDRCVLAPYFPPTEPHKFATAHRVFGASNIIKLLQELPEEHRSDAVSSMVYEASARIRDPVYGCAGAIWQLQKQV 109
                                6*********************************************************************************** PP

                     DUF260  88 eqlkaelallkee 100
                                + lka+la+++++
  Oropetium_20150105_15385A 110 NDLKAQLARAHAQ 122
                                ********99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.32922123IPR004883Lateral organ boundaries, LOB
PfamPF031951.9E-4026120IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MTLQHGPSTP PPPPSPXXXX XXXXXXCKIL RRRCVDRCVL APYFPPTEPH KFATAHRVFG  60
ASNIIKLLQE LPEEHRSDAV SSMVYEASAR IRDPVYGCAG AIWQLQKQVN DLKAQLARAH  120
AQQAHLLALV CCMEVDEHLA SPSPSPPVGP GAVAYCTVDY YSSQQQGAAD ALHVVDAGGL  180
QVMQANPVSW GDESIWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960340.14e-77PREDICTED: LOB domain-containing protein 1
SwissprotQ9LQR09e-53LBD1_ARATH; LOB domain-containing protein 1
SwissprotQ9SK083e-52LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A0A9FQU74e-78A0A0A9FQU7_ARUDO; Uncharacterized protein
STRINGSi024430m1e-76(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26453790
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.13e-49LOB domain-containing protein 1